PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa18g009600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-other
Protein Properties Length: 1705aa    MW: 191566 Da    PI: 5.0224
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa18g009600.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.45e-182480157
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                    ++kR   t+ qle+Le+ ++ ++yps++ r++L+ kl+L++rq ++WF+ rR k++k
  Csa18g009600.1 24 KSKRKMKTAAQLEVLETTYAAEPYPSEAIRADLSVKLNLSDRQLQMWFCHRRLKDRK 80
                    679****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-161180IPR009057Homeodomain-like
SuperFamilySSF466898.13E-151880IPR009057Homeodomain-like
PROSITE profilePS5007116.2442181IPR001356Homeobox domain
SMARTSM003899.7E-162385IPR001356Homeobox domain
CDDcd000867.79E-132481No hitNo description
PfamPF000461.2E-152480IPR001356Homeobox domain
PROSITE profilePS5082715.784533592IPR018501DDT domain
SMARTSM005712.0E-22533592IPR018501DDT domain
PfamPF027911.7E-16534589IPR018501DDT domain
PfamPF050661.1E-15715783IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156121.6E-6911952IPR028942WHIM1 domain
PfamPF156133.9E-1310841156IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1705 aa     Download sequence    Send to blast
MEGGSDEATV KNTKTTPEEG GESKSKRKMK TAAQLEVLET TYAAEPYPSE AIRADLSVKL  60
NLSDRQLQMW FCHRRLKDRK STTTTPSSKR QRKELITTPM AVESPKPAVN AADLVAGNEF  120
DSRRAARVSG GSGSGVVTVV RRFNEPSSAE VRAVGYMEAQ LGERLRDNGP ILGMEFDPLP  180
PGAFGMPIEM PSHRKASRQA FETSLYVRSD VKPNKDVRPI REYQFLPDLP SSRTDHSERV  240
SPSHHYGVPL DASVMRGSVV SAGHRDDYKI SPQIPNLNLA TRQGKPGHVY SPNLPEYDSP  300
YQKSYMDTPA QRNLNDHPIH EDPFVKSERE VGNEDEDDDA LQLERKRKNE EARISRELEA  360
HEKRIRRELE KQDMLRRKRE EQLRKEMERQ DRERRKEEER LLRERQREEE RFMKEQMREL  420
QRREKFLKKE TMRAEKMRQK EEMRREKEVA RLKAANERAI ARKIAKESME LIEDERLELM  480
EVAALTKGLP SMLALDFETL QNLDEYRDKQ VLFPPSSVKL KKPFTVKPWN GSDENVANLL  540
MVWRFLITFA DVFGLWPFTL DEFAQAFHDY DPRLMGEIHI VLLKTIIKDI EGVTRTLLTG  600
VGANQNTASN PGGGHPHVVE GAYAWGFDIR SWRRNLNVFT WPEILRQLAL SAGLGPQLKK  660
RNIKTVSVHD ENEANDSENV IFNLRKGVAA ENAFAKMQER GLSNPKRSRH RLTPGTVKFA  720
AFHVLSLEGE KGLTILDVAE KIQKSGLRDL TTSRTPEASV AAALSRDTKL FERVAPSTYC  780
VRASYRKEAG GAETILAEAR ERIRAFKSGI TDVEDVDDAD RDEDSESDVG DDPEMDLNPK  840
KEDPDALDIE NSVKVESVLE NGKTKAGLPL TPSLPEDIKD EKRDDILVDQ SLEDAVANDA  900
DSACFDESKL GEQWVQGLVE GDYSNLSSEE RLNALVALIG IAIEGNTIRV ALEERLEVAS  960
ALKKQMWGEV QLDKRWKEES LLRANYLSYP TAKPGLNSST PASGNQENSS ADVTPISSQD  1020
PLGLPQMDVN NVIAGPSLQL QDNVSGMENL QYQQQGGYTA DRERLRAQLK AYVGYKAEEL  1080
YVYRSLPLGQ DRRRNRYWRF SASASRNDPG CGRIFVELQD GRWRLIDSEE DFDYLVKSLD  1140
VRGVRESHLH FMLLKIEASF KEAVRKNVEA NPGLCSVSSS LDFDTAEIST TFKIELGDSN  1200
AIERCSVLQR FQSFEKWMWD NMLHPGALSA FKYGAKQSSP LFRICRTCAE LHLVEDICCP  1260
SCGQMRASPD VGELCFADQV AQLGDYSRGG DTGFILRSSI SSPLRIRLLK IQLALVEASL  1320
PPEGLEAFWT ENHRKSWGLK LLSSSSPEEL NQVLTTLEVA LKRDFLSSNF ETTSELLGLP  1380
EEALASDSTC VVNVLPWIPK TTGGVALRLF EFDSAIVYTP DQNNDPLKDK ESEDLVGLET  1440
NLLRNVPEKD VMETPVQGGY TQEDNWIDPG VGGVSSSGRG GRPARGRGRP RSRGSGGNGK  1500
KPAVSVSSSR PPRGAANTNG ETMLRPRAQP RSKKNGRRSS TKGRKRPTKG TLGISNEVVG  1560
GRLAKEVAVT ARTTLPDNED DWIETPELQD DDGEASSSGR SFQYKDYDDD EVMAPMDDFD  1620
DAGESSKLVG RGEFSLHSDV EYEEEEEDEE EEEEEDMNTK MDVNYINDDS FGRREQPEIS  1680
NDAARKRFMF DDPDLTSSSS SDYR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
115321546KKNGRRSSTKGRKRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0052390.0AB005239.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MLN1.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010481770.10.0PREDICTED: uncharacterized protein LOC104760525
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLR0EUK20.0R0EUK2_9BRAS; Uncharacterized protein
STRINGAT5G44180.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96012530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator